Lineage for d1xcba1 (1xcb A:4-77)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439050Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 439051Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 439052Species Thermus aquaticus [TaxId:271] [101009] (1 PDB entry)
    CASP5
  8. 439053Domain d1xcba1: 1xcb A:4-77 [109552]
    Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2

Details for d1xcba1

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

SCOP Domain Sequences for d1xcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcba1 a.4.5.38 (A:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

SCOP Domain Coordinates for d1xcba1:

Click to download the PDB-style file with coordinates for d1xcba1.
(The format of our PDB-style files is described here.)

Timeline for d1xcba1: