SCOP 1.69: Domain d1xcbd2: 1xcb D:78-203

Lineage for d1xcbd2 (1xcb D:78-203)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (1 protein)

6. Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
   forms swapped dimer with C-terminal helices

7. Species Thermus aquaticus [TaxId:271] [102176] (1 PDB entry)
   CASP5

8. Domain d1xcbd2: 1xcb D:78-203 [109559]
   Other proteins in same PDB: d1xcba1, d1xcbb1, d1xcbc1, d1xcbd1, d1xcbe1, d1xcbf1, d1xcbg1

Details for d1xcbd2

PDB Entry: 1xcb, 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

SCOP Domain Sequences for d1xcbd2:

Sequence; same for both SEQRES and ATOM records:

>d1xcbd2 c.2.1.12 (D:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

Timeline for d1xcbd2:

• d1xcbd2 is new in SCOP 1.69
  
• d1xcbd2 appears in SCOP 1.71
  
• d1xcbd2 appears in the current release, SCOPe 2.08