Lineage for d1xcbg2 (1xcb G:78-203)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478880Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (1 protein)
  6. 478881Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
    forms swapped dimer with C-terminal helices
  7. 478882Species Thermus aquaticus [TaxId:271] [102176] (1 PDB entry)
    CASP5
  8. 478889Domain d1xcbg2: 1xcb G:78-203 [109565]
    Other proteins in same PDB: d1xcba1, d1xcbb1, d1xcbc1, d1xcbd1, d1xcbe1, d1xcbf1, d1xcbg1

Details for d1xcbg2

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

SCOP Domain Sequences for d1xcbg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcbg2 c.2.1.12 (G:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

SCOP Domain Coordinates for d1xcbg2:

Click to download the PDB-style file with coordinates for d1xcbg2.
(The format of our PDB-style files is described here.)

Timeline for d1xcbg2: