Lineage for d1x8mb1 (1x8m B:2004-2268)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070417Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. 2070418Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. 2070426Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
    Uniprot Q46938 1-266
  8. 2070430Domain d1x8mb1: 1x8m B:2004-2268 [109517]
    Other proteins in same PDB: d1x8ma2, d1x8mb2, d1x8mc2, d1x8md2, d1x8me2, d1x8mf2

Details for d1x8mb1

PDB Entry: 1x8m (more details), 2.6 Å

PDB Description: X-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from Escherichia coli
PDB Compounds: (B:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOPe Domain Sequences for d1x8mb1:

Sequence, based on SEQRES records: (download)

>d1x8mb1 b.82.1.13 (B:2004-2268) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
dvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvgg
evgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidtg
tpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmgl
telapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisps
wsihsgvgtkaytfiwgmvgenqvf

Sequence, based on observed residues (ATOM records): (download)

>d1x8mb1 b.82.1.13 (B:2004-2268) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
dvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvgg
evgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidtg
tpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmgl
telapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsgvg
tkaytfiwgmvgenqvf

SCOPe Domain Coordinates for d1x8mb1:

Click to download the PDB-style file with coordinates for d1x8mb1.
(The format of our PDB-style files is described here.)

Timeline for d1x8mb1: