Lineage for d1x8me1 (1x8m E:5004-5268)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.13: KduI-like [110318] (1 protein)
    Pfam PF04962: duplication: consists of two germin-like domains
  6. Protein 5-keto-4-deoxyuronate isomerase KduI [110319] (2 species)
  7. Species Escherichia coli [TaxId:562] [110320] (2 PDB entries)
    Uniprot Q46938 1-266
  8. Domain d1x8me1: 1x8m E:5004-5268 [109520]
    Other proteins in same PDB: d1x8ma2, d1x8mb2, d1x8mc2, d1x8md2, d1x8me2, d1x8mf2

Details for d1x8me1

PDB Entry: 1x8m (more details), 2.6 Å

PDB Description: x-ray structure of pectin degrading enzyme 5-keto 4-deoxyuronate isomerase from escherichia coli
PDB Compounds: (E:) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase

SCOPe Domain Sequences for d1x8me1:

Sequence, based on SEQRES records: (download)

>d1x8me1 b.82.1.13 (E:5004-5268) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
dvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvgg
evgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidtg
tpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmgl
telapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavisps
wsihsgvgtkaytfiwgmvgenqvf

Sequence, based on observed residues (ATOM records): (download)

>d1x8me1 b.82.1.13 (E:5004-5268) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]}
dvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktvsvgg
evgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfasidtg
tpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcqlsmgl
telapgnlwntrmevyfyfnmdddacvfhmmgqpqetrhivmhneqavispswsihsgvg
tkaytfiwgmvgenqvf

SCOPe Domain Coordinates for d1x8me1 are not available.

Timeline for d1x8me1:

Domains from same chain:
(mouse over for more information)
d1x8me2
Domains from other chains:
(mouse over for more information)
d1x8ma1, d1x8ma2, d1x8mb1, d1x8mb2, d1x8mc1, d1x8mc2, d1x8md1, d1x8md2, d1x8mf1, d1x8mf2