![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165 |
![]() | Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) ![]() automatically mapped to Pfam PF06399 |
![]() | Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins) |
![]() | Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries) Uniprot P70552 |
![]() | Domain d1wplq_: 1wpl Q: [109488] Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_ complexed with 3po, hbi, na, zn |
PDB Entry: 1wpl (more details), 2.8 Å
SCOPe Domain Sequences for d1wplq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wplq_ d.205.1.1 (Q:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Norway rat (Rattus norvegicus) [TaxId: 10116]} mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl ecrgfrvlsmtgvgqtlvwclhke
Timeline for d1wplq_: