Lineage for d1wpli_ (1wpl I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2531296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2531297Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2531298Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 2531411Species Norway rat (Rattus norvegicus) [TaxId:10116] [69790] (3 PDB entries)
    Uniprot P22288
  8. 2531420Domain d1wpli_: 1wpl I: [109480]
    Other proteins in same PDB: d1wplk_, d1wpll_, d1wplm_, d1wpln_, d1wplo_, d1wplp_, d1wplq_, d1wplr_, d1wpls_, d1wplt_
    complexed with 3po, hbi, na, zn

Details for d1wpli_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
PDB Compounds: (I:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wpli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpli_ d.96.1.1 (I:) GTP cyclohydrolase I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
dpktreefltlirs

SCOPe Domain Coordinates for d1wpli_:

Click to download the PDB-style file with coordinates for d1wpli_.
(The format of our PDB-style files is described here.)

Timeline for d1wpli_: