PDB entry 1wpl

View 1wpl on RCSB PDB site
Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
Class: hydrolase/protein binding
Keywords: enzyme-regulatory protein complex, hydrolase/protein binding complex
Deposited on 2004-09-08, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpla_
  • Chain 'B':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplb_
  • Chain 'C':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplc_
  • Chain 'D':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpld_
  • Chain 'E':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wple_
  • Chain 'F':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplf_
  • Chain 'G':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplg_
  • Chain 'H':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplh_
  • Chain 'I':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpli_
  • Chain 'J':
    Compound: GTP cyclohydrolase I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplj_
  • Chain 'K':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplk_
  • Chain 'L':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpll_
  • Chain 'M':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplm_
  • Chain 'N':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpln_
  • Chain 'O':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplo_
  • Chain 'P':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplp_
  • Chain 'Q':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplq_
  • Chain 'R':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplr_
  • Chain 'S':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wpls_
  • Chain 'T':
    Compound: GTP Cyclohydrolase I Feedback Regulatory Protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wplt_
  • Heterogens: NA, ZN, HBI, 3PO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wplA (A:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplA (A:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wplB (B:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplB (B:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wplC (C:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplC (C:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wplD (D:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplD (D:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wplE (E:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplE (E:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wplF (F:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplF (F:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wplG (G:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplG (G:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wplH (H:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplH (H:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1wplI (I:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplI (I:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1wplJ (J:)
    gfperelprpgasrpaeksrppeakgaqpadawkagrprseednelnlpnlaaayssilr
    slgedpqrqgllktpwraatamqfftkgyqetisdvlndaifdedhdemvivkdidmfsm
    cehhlvpfvgrvhigylpnkqvlglsklariveiysrrlqvqerltkqiavaitealqpa
    gvgvvieathmcmvmrgvqkmnsktvtstmlgvfredpktreefltlirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wplJ (J:)
    rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
    lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
    rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
    dpktreefltlirs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplK (K:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplL (L:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplM (M:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplN (N:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplO (O:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplP (P:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplQ (Q:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplR (R:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplS (S:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wplT (T:)
    mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
    ecrgfrvlsmtgvgqtlvwclhke