Lineage for d1wplp_ (1wpl P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006220Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 3006221Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
    automatically mapped to Pfam PF06399
  5. 3006222Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (2 proteins)
  6. 3006223Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)
  7. 3006224Species Norway rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)
    Uniprot P70552
  8. 3006235Domain d1wplp_: 1wpl P: [109487]
    Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_
    complexed with 3po, hbi, na, zn

Details for d1wplp_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
PDB Compounds: (P:) GTP Cyclohydrolase I Feedback Regulatory Protein

SCOPe Domain Sequences for d1wplp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wplp_ d.205.1.1 (P:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

SCOPe Domain Coordinates for d1wplp_:

Click to download the PDB-style file with coordinates for d1wplp_.
(The format of our PDB-style files is described here.)

Timeline for d1wplp_: