Lineage for d1wplb_ (1wpl B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69790] (3 PDB entries)
    Uniprot P22288
  8. Domain d1wplb_: 1wpl B: [109473]
    Other proteins in same PDB: d1wplk_, d1wpll_, d1wplm_, d1wpln_, d1wplo_, d1wplp_, d1wplq_, d1wplr_, d1wpls_, d1wplt_
    complexed with 3po, hbi, na, zn

Details for d1wplb_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
PDB Compounds: (B:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wplb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wplb_ d.96.1.1 (B:) GTP cyclohydrolase I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
dpktreefltlirs

SCOPe Domain Coordinates for d1wplb_ are not available.

Timeline for d1wplb_: