![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein Ariadne-1 protein homolog [111459] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111460] (1 PDB entry) Uniprot Q9Y4X5 336-394 |
![]() | Domain d1wd2a1: 1wd2 A:11-69 [109232] Other proteins in same PDB: d1wd2a2 complexed with zn |
PDB Entry: 1wd2 (more details)
SCOPe Domain Sequences for d1wd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd2a1 g.44.1.1 (A:11-69) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnryne
Timeline for d1wd2a1: