PDB entry 1wd2

View 1wd2 on RCSB PDB site
Description: Solution Structure of the C-terminal RING from a RING-IBR-RING (TRIAD) motif
Class: ligase
Keywords: ring, ibr, triad, zinc finger, ligase
Deposited on 2004-05-11, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ariadne-1 protein homolog
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y4X5 (0-58)
    • cloning artifact (59)
  Domains in SCOPe 2.07: d1wd2a1, d1wd2a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wd2A (A:)
  wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnrynef