Lineage for d1wd2a_ (1wd2 A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524540Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 524541Superfamily g.44.1: RING/U-box [57850] (2 families) (S)
  5. 524542Family g.44.1.1: RING finger domain, C3HC4 [57851] (12 proteins)
  6. 524546Protein Ariadne-1 protein homolog [111459] (1 species)
  7. 524547Species Human (Homo sapiens) [TaxId:9606] [111460] (1 PDB entry)
  8. 524548Domain d1wd2a_: 1wd2 A: [109232]

Details for d1wd2a_

PDB Entry: 1wd2 (more details)

PDB Description: solution structure of the c-terminal ring from a ring-ibr-ring (triad) motif

SCOP Domain Sequences for d1wd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens)}
wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnrynef

SCOP Domain Coordinates for d1wd2a_:

Click to download the PDB-style file with coordinates for d1wd2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd2a_: