SCOPe 2.06: Domain d1wd2a1: 1wd2 A:11-69

Lineage for d1wd2a1 (1wd2 A:11-69)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Ariadne-1 protein homolog [111459] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111460] (1 PDB entry)
   Uniprot Q9Y4X5 336-394

8. Domain d1wd2a1: 1wd2 A:11-69 [109232]
   Other proteins in same PDB: d1wd2a2
   complexed with zn

Details for d1wd2a1

PDB Entry: 1wd2

PDB Description: solution structure of the c-terminal ring from a ring-ibr-ring (triad) motif

PDB Compounds: (A:) Ariadne-1 protein homolog

SCOPe Domain Sequences for d1wd2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wd2a1 g.44.1.1 (A:11-69) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]}
wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnryne

Timeline for d1wd2a1:

• d1wd2a1 first appeared in SCOP 1.69, called d1wd2a_
  
• d1wd2a1 was called d1wd2a_ in SCOPe 2.05
  
• d1wd2a1 appears in SCOPe 2.07
  
• d1wd2a1 appears in the current release, SCOPe 2.08