SCOPe 2.08: Domain d1w2yb_: 1w2y B:

Lineage for d1w2yb_ (1w2y B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
   one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains

6. Protein Type II deoxyuridine triphosphatase [101388] (2 species)

7. Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries)
   Uniprot Q9PMK9

8. Domain d1w2yb_: 1w2y B: [109141]
   complexed with dun, mg

Details for d1w2yb_

PDB Entry: 1w2y, 1.65 Å

PDB Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhp

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotide hydrolase

SCOPe Domain Sequences for d1w2yb_:

Sequence, based on SEQRES records:

>d1w2yb_ a.204.1.1 (B:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka

Sequence, based on observed residues (ATOM records):

>d1w2yb_ a.204.1.1 (B:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllledfkaiatevnavsvfqdfckgdiygilndiel
iihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnngykdgsykkt
wngkednevlaqileqtiykkleecykka

Timeline for d1w2yb_:

• d1w2yb_ first appeared in SCOP 1.69
  
• d1w2yb_ appears in SCOPe 2.07