Lineage for d1w2ya_ (1w2y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014645Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2014646Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2014647Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
    one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains
  6. 2014648Protein Type II deoxyuridine triphosphatase [101388] (2 species)
  7. 2014649Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries)
    Uniprot Q9PMK9
  8. 2014650Domain d1w2ya_: 1w2y A: [109140]
    complexed with dun, mg

Details for d1w2ya_

PDB Entry: 1w2y (more details), 1.65 Å

PDB Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotide hydrolase

SCOPe Domain Sequences for d1w2ya_:

Sequence, based on SEQRES records: (download)

>d1w2ya_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka

Sequence, based on observed residues (ATOM records): (download)

>d1w2ya_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeynnkdfkaiatevnavsvfqdfckeeeypne
gdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrq
nngykdgsykktwngkednevlaqileqeldfdtiykkleecykka

SCOPe Domain Coordinates for d1w2ya_:

Click to download the PDB-style file with coordinates for d1w2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ya_: