PDB entry 1w2y

View 1w2y on RCSB PDB site
Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhp
Class: hydrolase
Keywords: dutp pyrophosphatase, dimeric, ligand complex, magnesium ions, pathogen, drug target, hydrolase
Deposited on 2004-07-09, released 2004-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.153
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotide hydrolase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w2ya_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotide hydrolase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w2yb_
  • Heterogens: DUN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w2yA (A:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
    pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
    frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2yA (A:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllleeynnkdfkaiatevnavsvfqdfckeeeypne
    gdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrq
    nngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w2yB (B:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
    pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
    frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w2yB (B:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllledfkaiatevnavsvfqdfckgdiygilndiel
    iihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnngykdgsykkt
    wngkednevlaqileqtiykkleecykka