Lineage for d1w0kg_ (1w0k G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881031Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2881032Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2881047Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 2881060Domain d1w0kg_: 1w0k G: [109026]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3
    complexed with adp, gol, mg, po4
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1w0kg_

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (G:) ATP synthase gamma chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0kg_:

Sequence, based on SEQRES records: (download)

>d1w0kg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1w0kg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOPe Domain Coordinates for d1w0kg_:

Click to download the PDB-style file with coordinates for d1w0kg_.
(The format of our PDB-style files is described here.)

Timeline for d1w0kg_: