Lineage for d1w0kb1 (1w0k B:380-510)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000218Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2000219Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2000220Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 protein domains)
  6. 2000221Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2000240Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2000257Domain d1w0kb1: 1w0k B:380-510 [109011]
    Other proteins in same PDB: d1w0ka2, d1w0ka3, d1w0kb2, d1w0kb3, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3, d1w0kg_
    complexed with adp, gol, mg, po4

Details for d1w0kb1

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (B:) ATP synthase alpha chain heart isoform, mitochondrial precursor

SCOPe Domain Sequences for d1w0kb1:

Sequence, based on SEQRES records: (download)

>d1w0kb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1w0kb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnflag
fea

SCOPe Domain Coordinates for d1w0kb1:

Click to download the PDB-style file with coordinates for d1w0kb1.
(The format of our PDB-style files is described here.)

Timeline for d1w0kb1: