Lineage for d1w0kg_ (1w0k G:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487418Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 487516Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (1 family) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 487517Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 487518Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 487519Species Cow (Bos taurus) [TaxId:9913] [52946] (12 PDB entries)
  8. 487521Domain d1w0kg_: 1w0k G: [109026]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3

Details for d1w0kg_

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0kg_:

Sequence, based on SEQRES records: (download)

>d1w0kg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1w0kg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOP Domain Coordinates for d1w0kg_:

Click to download the PDB-style file with coordinates for d1w0kg_.
(The format of our PDB-style files is described here.)

Timeline for d1w0kg_: