Lineage for d1w0kf3 (1w0k F:82-357)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. Domain d1w0kf3: 1w0k F:82-357 [109025]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0ke1, d1w0ke2, d1w0kf1, d1w0kf2, d1w0kg_
    complexed with adp, gol, mg, po4

Details for d1w0kf3

PDB Entry: 1w0k (more details), 2.8499999999999996 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (F:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0kf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0kf3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d1w0kf3 are not available.

Timeline for d1w0kf3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w0kf1, d1w0kf2
View in 3D
Domains from other chains:
(mouse over for more information)
d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kg_