Lineage for d1vlwa1 (1vlw A:1-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834863Protein KDPG aldolase [51584] (3 species)
  7. 2834886Species Thermotoga maritima [TaxId:2336] [110357] (1 PDB entry)
    Uniprot Q9WXS1
  8. 2834887Domain d1vlwa1: 1vlw A:1-203 [108868]
    Other proteins in same PDB: d1vlwa2, d1vlwb2, d1vlwc2
    Structural genomics target

Details for d1vlwa1

PDB Entry: 1vlw (more details), 2.3 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase

SCOPe Domain Sequences for d1vlwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlwa1 c.1.10.1 (A:1-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]}
mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
lvkgtpdevrekakafvekirgc

SCOPe Domain Coordinates for d1vlwa1:

Click to download the PDB-style file with coordinates for d1vlwa1.
(The format of our PDB-style files is described here.)

Timeline for d1vlwa1: