PDB entry 1vlw

View 1vlw on RCSB PDB site
Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution
Class: lyase
Keywords: TM0066, 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXOGLUTARATE ALDOLASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, LYASE
Deposited on 2004-08-18, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXS1 (12-End)
      • leader sequence (10-11)
    Domains in SCOPe 2.07: d1vlwa1, d1vlwa2
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXS1 (12-End)
      • leader sequence (9-11)
    Domains in SCOPe 2.07: d1vlwb1, d1vlwb2
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXS1 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.07: d1vlwc1, d1vlwc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vlwA (A:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwA (A:)
    hhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsfl
    kekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelv
    kamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvg
    salvkgtpdevrekakafvekirgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vlwB (B:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwB (B:)
    hhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsf
    lkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptel
    vkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgv
    gsalvkgtpdevrekakafvekirgct
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vlwC (C:)
    mgsdkihhhhhhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpda
    dtvikelsflkekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfym
    pgvmtptelvkamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewf
    kagvlavgvgsalvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vlwC (C:)
    hmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflk
    ekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvk
    amklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgs
    alvkgtpdevrekakafvekirgc