Lineage for d1vlwa_ (1vlw A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475346Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 475531Protein KDPG aldolase [51584] (3 species)
  7. 475547Species Thermotoga maritima [TaxId:243274] [110357] (1 PDB entry)
  8. 475548Domain d1vlwa_: 1vlw A: [108868]

Details for d1vlwa_

PDB Entry: 1vlw (more details), 2.3 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TM0066) from Thermotoga maritima at 2.30 A resolution

SCOP Domain Sequences for d1vlwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlwa_ c.1.10.1 (A:) KDPG aldolase {Thermotoga maritima}
hhmkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsfl
kekgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelv
kamklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvg
salvkgtpdevrekakafvekirgc

SCOP Domain Coordinates for d1vlwa_:

Click to download the PDB-style file with coordinates for d1vlwa_.
(The format of our PDB-style files is described here.)

Timeline for d1vlwa_: