SCOPe 2.08: Domain d1vl0a1: 1vl0 A:1-280

Lineage for d1vl0a1 (1vl0 A:1-280)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein DTDP-4-dehydrorhamnose reductase RfbD [110409] (1 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [110410] (1 PDB entry)
   Uniprot Q97GQ1

8. Domain d1vl0a1: 1vl0 A:1-280 [108704]
   Other proteins in same PDB: d1vl0a2, d1vl0c2
   Structural genomics target
   complexed with nai, unl
   has additional subdomain(s) that are not in the common domain

Details for d1vl0a1

PDB Entry: 1vl0, 2.05 Å

PDB Description: crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution

PDB Compounds: (A:) DTDP-4-dehydrorhamnose reductase, rfbD ortholog

SCOPe Domain Sequences for d1vl0a1:

Sequence; same for both SEQRES and ATOM records:

>d1vl0a1 c.2.1.2 (A:1-280) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}
mkilitgangqlgreiqkqlkgknveviptdvqdlditnvlavnkffnekkpnvvincaa
htavdkceeqydlaykinaigpknlaaaaysvgaeivqistdyvfdgeakepitefdevn
pqsaygktklegenfvkalnpkyyivrtawlygdgnnfvktminlgkthdelkvvhdqvg
tptstvdlarvvlkvideknygtfhctckgicswydfaveifrltgidvkvtpctteefp
rpakrpkysvlrnymlelttgditrewkeslkeyidllqm

Timeline for d1vl0a1:

• d1vl0a1 first appeared in SCOP 1.69, called d1vl0a_
  
• d1vl0a1 appears in SCOPe 2.07