![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein DTDP-4-dehydrorhamnose reductase RfbD [110409] (1 species) |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [110410] (1 PDB entry) Uniprot Q97GQ1 |
![]() | Domain d1vl0b_: 1vl0 B: [108705] Other proteins in same PDB: d1vl0a2, d1vl0c2 Structural genomics target complexed with nai, unl has additional subdomain(s) that are not in the common domain |
PDB Entry: 1vl0 (more details), 2.05 Å
SCOPe Domain Sequences for d1vl0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vl0b_ c.2.1.2 (B:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} mkilitgangqlgreiqkqlkgknveviptdvqdlditnvlavnkffnekkpnvvincaa htavdkceeqydlaykinaigpknlaaaaysvgaeivqistdyvfdgeakepitefdevn pqsaygktklegenfvkalnpkyyivrtawlygdgnnfvktminlgkthdelkvvhdqvg tptstvdlarvvlkvideknygtfhctckgicswydfaveifrltgidvkvtpctteefp rpakrpkysvlrnymlelttgditrewkeslkeyidllqm
Timeline for d1vl0b_:
![]() Domains from other chains: (mouse over for more information) d1vl0a1, d1vl0a2, d1vl0c1, d1vl0c2 |