Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab7 [110540] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries) Uniprot P09527 |
Domain d1vg8c_: 1vg8 C: [108608] complexed with gnp, mg |
PDB Entry: 1vg8 (more details), 1.7 Å
SCOPe Domain Sequences for d1vg8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vg8c_ c.37.1.8 (C:) Rab7 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn
Timeline for d1vg8c_: