Lineage for d1vg8a_ (1vg8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867484Protein Rab7 [110540] (2 species)
  7. 2867491Species Norway rat (Rattus norvegicus) [TaxId:10116] [110541] (4 PDB entries)
    Uniprot P09527
  8. 2867492Domain d1vg8a_: 1vg8 A: [108606]
    complexed with gnp, mg

Details for d1vg8a_

PDB Entry: 1vg8 (more details), 1.7 Å

PDB Description: gppnhp-bound rab7
PDB Compounds: (A:) Ras-related protein Rab-7

SCOPe Domain Sequences for d1vg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg8a_ c.37.1.8 (A:) Rab7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
pepi

SCOPe Domain Coordinates for d1vg8a_:

Click to download the PDB-style file with coordinates for d1vg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1vg8a_: