PDB entry 1vg8

View 1vg8 on RCSB PDB site
Description: GPPNHP-Bound Rab7
Class: protein transport
Keywords: GTP-binding protein, PROTEIN TRANSPORT
Deposited on 2004-04-23, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vg8a_
  • Chain 'B':
    Compound: Ras-related protein Rab-7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vg8b_
  • Chain 'C':
    Compound: Ras-related protein Rab-7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vg8c_
  • Chain 'D':
    Compound: Ras-related protein Rab-7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vg8d_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vg8A (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8A (A:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
    pepi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vg8B (B:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8B (B:)
    kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
    gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
    kidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vg8C (C:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8C (C:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelyn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vg8D (D:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtagqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev
    elynefpepikldknerakasaescsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vg8D (D:)
    vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
    qerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
    idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevelynef
    pepi