Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries) Uniprot Q8VP75 |
Domain d1velf_: 1vel F: [108537] complexed with cd, na, so4 |
PDB Entry: 1vel (more details), 2.99 Å
SCOPe Domain Sequences for d1velf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1velf_ a.25.1.1 (F:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk siekledldlvsqdlliahagelekfqwfvrahlesaggqlth
Timeline for d1velf_: