Lineage for d1vele_ (1vel E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein Dodecameric ferritin homolog [47250] (16 species)
  7. Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. Domain d1vele_: 1vel E: [108536]
    complexed with cd, na, so4

Details for d1vele_

PDB Entry: 1vel (more details), 2.99 Å

PDB Description: Mycobacterium smegmatis Dps tetragonal form
PDB Compounds: (E:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1vele_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vele_ a.25.1.1 (E:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlth

SCOPe Domain Coordinates for d1vele_ are not available.

Timeline for d1vele_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vela_, d1velb_, d1velc_, d1veld_, d1velf_