SCOPe 2.08: Domain d1vela_: 1vel A:

Lineage for d1vela_ (1vel A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
   Uniprot Q8VP75

8. Domain d1vela_: 1vel A: [108532]
   complexed with cd, na, so4

Details for d1vela_

PDB Entry: 1vel, 2.99 Å

PDB Description: Mycobacterium smegmatis Dps tetragonal form

PDB Compounds: (A:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d1vela_:

Sequence; same for both SEQRES and ATOM records:

>d1vela_ a.25.1.1 (A:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
sftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvr
gyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrk
siekledldlvsqdlliahagelekfqwfvrahlesaggqlth

Timeline for d1vela_:

• d1vela_ first appeared in SCOP 1.69
  
• d1vela_ appears in SCOPe 2.07