Lineage for d1v5ja1 (1v5j A:8-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762048Protein KIAA1355 [110058] (1 species)
  7. 2762049Species Human (Homo sapiens) [TaxId:9606] [110059] (1 PDB entry)
    Uniprot Q9P2J2 [Fragment] 634-728
  8. 2762050Domain d1v5ja1: 1v5j A:8-102 [108376]
    Other proteins in same PDB: d1v5ja2, d1v5ja3
    Structural genomics target

Details for d1v5ja1

PDB Entry: 1v5j (more details)

PDB Description: solution structure of rsgi ruh-008, fn3 domain in human cdna
PDB Compounds: (A:) KIAA1355 protein

SCOPe Domain Sequences for d1v5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ja1 b.1.2.1 (A:8-102) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}
lspprglvavrtprgvllhwdppelvpkrldgyvlegrqgsqgwevldpavagtetellv
pglikdvlyefrlvafagsfvsdpsntanvstsgl

SCOPe Domain Coordinates for d1v5ja1:

Click to download the PDB-style file with coordinates for d1v5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ja1: