![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein KIAA1355 [110058] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110059] (1 PDB entry) Uniprot Q9P2J2 [Fragment] 634-728 |
![]() | Domain d1v5ja1: 1v5j A:8-102 [108376] Other proteins in same PDB: d1v5ja2, d1v5ja3 Structural genomics target |
PDB Entry: 1v5j (more details)
SCOPe Domain Sequences for d1v5ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ja1 b.1.2.1 (A:8-102) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} lspprglvavrtprgvllhwdppelvpkrldgyvlegrqgsqgwevldpavagtetellv pglikdvlyefrlvafagsfvsdpsntanvstsgl
Timeline for d1v5ja1: