Lineage for d1v5ja_ (1v5j A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (24 proteins) 
Protein KIAA1355 [110058] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110059] (1 PDB entry) 
Domain d1v5ja_: 1v5j A: [108376]
Structural genomics target
Details for d1v5ja_
PDB Entry: 1v5j (more details)
PDB Description: solution structure of rsgi ruh-008, fn3 domain in human cdna
SCOP Domain Sequences for d1v5ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens)}
gssgssglspprglvavrtprgvllhwdppelvpkrldgyvlegrqgsqgwevldpavag
tetellvpglikdvlyefrlvafagsfvsdpsntanvstsglsgpssg
SCOP Domain Coordinates for d1v5ja_:
Click to download the PDB-style file with coordinates for d1v5ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v5ja_:
- d1v5ja_ is new in SCOP 1.69
- d1v5ja_ appears in SCOP 1.71
- d1v5ja_ appears in the current release, SCOPe 2.08, called d1v5ja1
View in 3D