PDB entry 1v5j

View 1v5j on RCSB PDB site
Description: Solution Structure of RSGI RUH-008, fn3 domain in Human cDNA
Class: cell adhesion
Keywords: fn3 domain, human cDNA, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1355 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA KIAA1355
    Database cross-references and differences (RAF-indexed):
    • GB BAA92593 (7-101)
      • cloning artifact (0-6)
      • cloning artifact (102-107)
    Domains in SCOPe 2.08: d1v5ja1, d1v5ja2, d1v5ja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v5jA (A:)
gssgssglspprglvavrtprgvllhwdppelvpkrldgyvlegrqgsqgwevldpavag
tetellvpglikdvlyefrlvafagsfvsdpsntanvstsglsgpssg