Lineage for d1umob_ (1umo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2685987Protein Cytoglobin [109626] (1 species)
  7. 2685988Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
    Uniprot Q8WWM9 18-171
  8. 2686002Domain d1umob_: 1umo B: [107960]
    complexed with hem

Details for d1umob_

PDB Entry: 1umo (more details), 2.59 Å

PDB Description: the crystal structure of cytoglobin: the fourth globin type discovered in man
PDB Compounds: (B:) cytoglobin

SCOPe Domain Sequences for d1umob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umob_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

SCOPe Domain Coordinates for d1umob_:

Click to download the PDB-style file with coordinates for d1umob_.
(The format of our PDB-style files is described here.)

Timeline for d1umob_: