PDB entry 1umo

View 1umo on RCSB PDB site
Description: The crystal structure of cytoglobin: the fourth globin type discovered in man
Class: oxygen storage/transport
Keywords: OXYGEN STORAGE/TRANSPORT, CYTOGLOBIN, OXYGEN STORAGE, HISTOGLOBIN, HGB, TRANSPORT, STAP, OXYGEN STORAGE-TRANSPORT complex
Deposited on 2003-08-26, released 2004-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.08: d1umoa_
  • Chain 'B':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (82)
    Domains in SCOPe 2.08: d1umob_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1umoA (A:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umoA (A:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1umoB (B:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1umoB (B:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw