SCOPe 2.08: Domain d1umoa_: 1umo A:

Lineage for d1umoa_ (1umo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Cytoglobin [109626] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
   Uniprot Q8WWM9 18-171

8. Domain d1umoa_: 1umo A: [107959]
   complexed with hem

Details for d1umoa_

PDB Entry: 1umo, 2.59 Å

PDB Description: the crystal structure of cytoglobin: the fourth globin type discovered in man

PDB Compounds: (A:) cytoglobin

SCOPe Domain Sequences for d1umoa_:

Sequence; same for both SEQRES and ATOM records:

>d1umoa_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d1umoa_:

• d1umoa_ first appeared in SCOP 1.69
  
• d1umoa_ appears in SCOPe 2.07