Lineage for d1uhla_ (1uhl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009304Protein Retinoid-X receptor beta (RXR-beta) [74792] (1 species)
  7. 2009305Species Human (Homo sapiens) [TaxId:9606] [74793] (2 PDB entries)
    Uniprot P28702 298-528
  8. 2009310Domain d1uhla_: 1uhl A: [107849]
    Other proteins in same PDB: d1uhlb1, d1uhlb2
    complexed with 444, mei

Details for d1uhla_

PDB Entry: 1uhl (more details), 2.9 Å

PDB Description: Crystal structure of the LXRalfa-RXRbeta LBD heterodimer
PDB Compounds: (A:) Retinoic acid receptor RXR-beta

SCOPe Domain Sequences for d1uhla_:

Sequence, based on SEQRES records: (download)

>d1uhla_ a.123.1.1 (A:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
empvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakri
phfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaif
drvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckq
kypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d1uhla_ a.123.1.1 (A:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens) [TaxId: 9606]}
empvdrileaelaveqspndpvtnicqaadkqlftlvewakriphfsslplddqvillra
gwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmd
ktelgclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmemlea

SCOPe Domain Coordinates for d1uhla_:

Click to download the PDB-style file with coordinates for d1uhla_.
(The format of our PDB-style files is described here.)

Timeline for d1uhla_: