Lineage for d1uhla_ (1uhl A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448320Protein Retinoid-X receptor beta (RXR-beta) [74792] (1 species)
  7. 448321Species Human (Homo sapiens) [TaxId:9606] [74793] (2 PDB entries)
  8. 448326Domain d1uhla_: 1uhl A: [107849]
    Other proteins in same PDB: d1uhlb_

Details for d1uhla_

PDB Entry: 1uhl (more details), 2.9 Å

PDB Description: crystal structure of the lxralfa-rxrbeta lbd heterodimer

SCOP Domain Sequences for d1uhla_:

Sequence, based on SEQRES records: (download)

>d1uhla_ a.123.1.1 (A:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens)}
empvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakri
phfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaif
drvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckq
kypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d1uhla_ a.123.1.1 (A:) Retinoid-X receptor beta (RXR-beta) {Human (Homo sapiens)}
empvdrileaelaveqspndpvtnicqaadkqlftlvewakriphfsslplddqvillra
gwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmd
ktelgclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmemlea

SCOP Domain Coordinates for d1uhla_:

Click to download the PDB-style file with coordinates for d1uhla_.
(The format of our PDB-style files is described here.)

Timeline for d1uhla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uhlb_