PDB entry 1uhl

View 1uhl on RCSB PDB site
Description: Crystal structure of the LXRalfa-RXRbeta LBD heterodimer
Class: DNA binding protein
Keywords: ligand-binding domain, DNA BINDING PROTEIN
Deposited on 2003-07-03, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uhla_
  • Chain 'B':
    Compound: Oxysterols receptor LXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13133 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d1uhlb1, d1uhlb2
  • Chain 'C':
    Compound: 10-mer peptide from Nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 10-mer peptide from Nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 444, MEI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uhlA (A:)
    empvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakri
    phfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaif
    drvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckq
    kypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhlA (A:)
    empvdrileaelaveqspndpvtnicqaadkqlftlvewakriphfsslplddqvillra
    gwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmd
    ktelgclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlp
    alrsiglkclehlfffkligdtpidtflmemlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uhlB (B:)
    mspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpmapdphsrearqqrfahftelaivsv
    qeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynred
    fakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhty
    vealhayvsihhphdrlmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
    he
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhlB (B:)
    mspeqlgmieklvaaqqqcnrrsfearqqrfahftelaivsvqeivdfakqlpgflqlsr
    edqiallktsaievmlletsrrynpgsesitdfsynredfakaglqvefinpifefsram
    nelqlndaefalliaisifsadrpnvqdqlqverlqhtyvealhayvsihhphdrlmfpr
    mlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.