Lineage for d1uhlb1 (1uhl B:207-445)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008904Protein Oxysterols receptor LXR-alpha [109988] (2 species)
  7. 2008905Species Human (Homo sapiens) [TaxId:9606] [109989] (1 PDB entry)
    Uniprot Q13133 207-445
  8. 2008906Domain d1uhlb1: 1uhl B:207-445 [107850]
    Other proteins in same PDB: d1uhla_, d1uhlb2
    complexed with 444, mei

Details for d1uhlb1

PDB Entry: 1uhl (more details), 2.9 Å

PDB Description: Crystal structure of the LXRalfa-RXRbeta LBD heterodimer
PDB Compounds: (B:) Oxysterols receptor LXR-alpha

SCOPe Domain Sequences for d1uhlb1:

Sequence, based on SEQRES records: (download)

>d1uhlb1 a.123.1.1 (B:207-445) Oxysterols receptor LXR-alpha {Human (Homo sapiens) [TaxId: 9606]}
speqlgmieklvaaqqqcnrrsfsdrlrvtpwpmapdphsrearqqrfahftelaivsvq
eivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynredf
akaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqhtyv
ealhayvsihhphdrlmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

Sequence, based on observed residues (ATOM records): (download)

>d1uhlb1 a.123.1.1 (B:207-445) Oxysterols receptor LXR-alpha {Human (Homo sapiens) [TaxId: 9606]}
speqlgmieklvaaqqqcnrrsfearqqrfahftelaivsvqeivdfakqlpgflqlsre
dqiallktsaievmlletsrrynpgsesitdfsynredfakaglqvefinpifefsramn
elqlndaefalliaisifsadrpnvqdqlqverlqhtyvealhayvsihhphdrlmfprm
lmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOPe Domain Coordinates for d1uhlb1:

Click to download the PDB-style file with coordinates for d1uhlb1.
(The format of our PDB-style files is described here.)

Timeline for d1uhlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uhlb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uhla_