Lineage for d1ug7a1 (1ug7 A:8-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700744Superfamily a.24.24: Domain from hypothetical 2610208m17rik protein [109779] (1 family) (S)
    automatically mapped to Pfam PF08910
  5. 2700745Family a.24.24.1: Domain from hypothetical 2610208m17rik protein [109780] (1 protein)
  6. 2700746Protein Domain from hypothetical 2610208m17rik protein [109781] (1 species)
  7. 2700747Species Mouse (Mus musculus) [TaxId:10090] [109782] (1 PDB entry)
    Uniprot Q8C4Q6 1-115
  8. 2700748Domain d1ug7a1: 1ug7 A:8-122 [107824]
    Other proteins in same PDB: d1ug7a2, d1ug7a3
    Structural genomics target

Details for d1ug7a1

PDB Entry: 1ug7 (more details)

PDB Description: solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
PDB Compounds: (A:) 2610208M17Rik protein

SCOPe Domain Sequences for d1ug7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug7a1 a.24.24.1 (A:8-122) Domain from hypothetical 2610208m17rik protein {Mouse (Mus musculus) [TaxId: 10090]}
msevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnnsefteeqk
ktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvqpi

SCOPe Domain Coordinates for d1ug7a1:

Click to download the PDB-style file with coordinates for d1ug7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug7a1: