![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.24: Domain from hypothetical 2610208m17rik protein [109779] (1 family) ![]() automatically mapped to Pfam PF08910 |
![]() | Family a.24.24.1: Domain from hypothetical 2610208m17rik protein [109780] (1 protein) |
![]() | Protein Domain from hypothetical 2610208m17rik protein [109781] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109782] (1 PDB entry) Uniprot Q8C4Q6 1-115 |
![]() | Domain d1ug7a1: 1ug7 A:8-122 [107824] Other proteins in same PDB: d1ug7a2, d1ug7a3 Structural genomics target |
PDB Entry: 1ug7 (more details)
SCOPe Domain Sequences for d1ug7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug7a1 a.24.24.1 (A:8-122) Domain from hypothetical 2610208m17rik protein {Mouse (Mus musculus) [TaxId: 10090]} msevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnnsefteeqk ktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvqpi
Timeline for d1ug7a1: