Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1ug7a_ (1ug7 A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.24: Domain from hypothetical 2610208m17rik protein [109779] (1 family) (S)
  5. Family a.24.24.1: Domain from hypothetical 2610208m17rik protein [109780] (1 protein)
  6. Protein Domain from hypothetical 2610208m17rik protein [109781] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [109782] (1 PDB entry)
    Uniprot Q8C4Q6 1-115
  8. Domain d1ug7a_: 1ug7 A: [107824]
    Structural genomics target

Details for d1ug7a_

PDB Entry: 1ug7 (more details)
PDB Description: solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
PDB Compounds: (A:) 2610208M17Rik protein

SCOP Domain Sequences for d1ug7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug7a_ a.24.24.1 (A:) Domain from hypothetical 2610208m17rik protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
pisgpssg

SCOP Domain Coordinates for d1ug7a_:

Click to download the PDB-style file with coordinates for d1ug7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ug7a_:

d1ug7a_ appears in SCOP 1.75A


d1ug7a_
(click for larger image)

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu