PDB entry 1ug7

View 1ug7 on RCSB PDB site
Description: Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
Class: structural genomics, unknown function
Keywords: hypothetical protein FLJ12806, four helical up-and-down bundle, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-06-13, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2610208M17Rik protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610208M17
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ug7a1, d1ug7a2, d1ug7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug7A (A:)
    gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
    efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
    pisgpssg