Lineage for d1ug7a_ (1ug7 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 441055Superfamily a.24.24: Domain from hypothetical 2610208m17rik protein [109779] (1 family) (S)
  5. 441056Family a.24.24.1: Domain from hypothetical 2610208m17rik protein [109780] (1 protein)
  6. 441057Protein Domain from hypothetical 2610208m17rik protein [109781] (1 species)
  7. 441058Species Mouse (Mus musculus) [TaxId:10090] [109782] (1 PDB entry)
  8. 441059Domain d1ug7a_: 1ug7 A: [107824]
    Structural genomics target

Details for d1ug7a_

PDB Entry: 1ug7 (more details)

PDB Description: solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806

SCOP Domain Sequences for d1ug7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug7a_ a.24.24.1 (A:) Domain from hypothetical 2610208m17rik protein {Mouse (Mus musculus)}
gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
pisgpssg

SCOP Domain Coordinates for d1ug7a_:

Click to download the PDB-style file with coordinates for d1ug7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ug7a_: