Lineage for d1uesb1 (1ues B:201-284)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719058Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1719059Protein Cambialistic superoxide dismutase [46622] (2 species)
    active with either Fe or Mn
  7. 1719060Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
    Uniprot P19665
  8. 1719066Domain d1uesb1: 1ues B:201-284 [107800]
    Other proteins in same PDB: d1uesa2, d1uesb2, d1uesc2, d1uesd2
    complexed with mn

Details for d1uesb1

PDB Entry: 1ues (more details), 1.6 Å

PDB Description: crystal structure of porphyromonas gingivalis sod
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1uesb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uesb1 a.2.11.1 (B:201-284) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOPe Domain Coordinates for d1uesb1:

Click to download the PDB-style file with coordinates for d1uesb1.
(The format of our PDB-style files is described here.)

Timeline for d1uesb1: