Lineage for d1u78a1 (1u78 A:2-54)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. Protein Transposase tc3a1-65 [46733] (1 species)
  7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [46734] (2 PDB entries)
    Uniprot P34257 2-104
  8. Domain d1u78a1: 1u78 A:2-54 [107712]
    protein/DNA complex

Details for d1u78a1

PDB Entry: 1u78 (more details), 2.69 Å

PDB Description: Structure of the bipartite DNA-binding domain of Tc3 transposase bound to transposon DNA
PDB Compounds: (A:) transposable element tc3 transposase

SCOPe Domain Sequences for d1u78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u78a1 a.4.1.2 (A:2-54) Transposase tc3a1-65 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskr

SCOPe Domain Coordinates for d1u78a1 are not available.

Timeline for d1u78a1:

Domains from same chain:
(mouse over for more information)
d1u78a2