| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
| Protein Transposase tc3a1-65 [46733] (1 species) |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [46734] (2 PDB entries) Uniprot P34257 2-104 |
| Domain d1u78a1: 1u78 A:2-54 [107712] protein/DNA complex |
PDB Entry: 1u78 (more details), 2.69 Å
SCOPe Domain Sequences for d1u78a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u78a1 a.4.1.2 (A:2-54) Transposase tc3a1-65 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskr
Timeline for d1u78a1: