PDB entry 1u78

View 1u78 on RCSB PDB site
Description: Structure of the bipartite DNA-binding domain of Tc3 transposase bound to transposon DNA
Class: DNA binding protein/DNA
Keywords: transposase, transposon DNA, bipartite DNA-binding, HTH-motif, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2004-08-03, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.235
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transposable element tc3 transposase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: Tc3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34257
      • engineered (40)
    Domains in SCOPe 2.07: d1u78a1, d1u78a2
  • Chain 'B':
    Compound: 26-mer
  • Chain 'C':
    Compound: 26-mer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u78A (A:)
    mprgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskraprrka
    lsvrdernviraasnscktardirnelqlsaskrtilnvikrsgvivrqklrpapllsad
    hklkrlefaknnmgthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u78A (A:)
    prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskraprrkal
    svrdernviraasnscktardirnelqlsaskrtilnvikrsg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.