SCOPe 2.03: Domain d1u3ca2: 1u3c A:13-197

Lineage for d1u3ca2 (1u3c A:13-197)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)

6. Protein Cryptochrome [82367] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110496] (2 PDB entries)
   Uniprot Q43125 13-497

8. Domain d1u3ca2: 1u3c A:13-197 [107637]
   Other proteins in same PDB: d1u3ca1
   complexed with cl, fad, hez, mg, nds

Details for d1u3ca2

PDB Entry: 1u3c, 2.6 Å

PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana

PDB Compounds: (A:) Cryptochrome 1 apoprotein

SCOPe Domain Sequences for d1u3ca2:

Sequence; same for both SEQRES and ATOM records:

>d1u3ca2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsrwwlknslaqlds
slrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdhrakdvltaqgia
vrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppkkiisgdvskcva
dplvf

Timeline for d1u3ca2:

• d1u3ca2 first appeared in SCOP 1.69
  
• d1u3ca2 appears in SCOPe 2.02
  
• d1u3ca2 appears in SCOPe 2.04
  
• d1u3ca2 appears in the current release, SCOPe 2.08